ACSF2 Antibody

Images

 
Western Blot: ACSF2 Antibody [NBP2-47558] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: ACSF2 Antibody [NBP2-47558] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACSF2 Antibody [NBP2-47558] - Staining in human kidney and smooth muscle tissues using anti-ACSF2 antibody. Corresponding ACSF2 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: ACSF2 Antibody [NBP2-47558] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ACSF2 Antibody [NBP2-47558] - Staining of human smooth muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACSF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGEN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACSF2 Protein (NBP2-47558PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSF2 Antibody

  • ACSMW
  • acyl-CoA synthetase family member 2
  • AVYV493
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.26
  • mitochondrial
  • PPARG binding, long chain fatty acid acyl Co-A ligase like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACSF2 Antibody (NBP2-47558) (0)

There are no publications for ACSF2 Antibody (NBP2-47558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSF2 Antibody (NBP2-47558) (0)

There are no reviews for ACSF2 Antibody (NBP2-47558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACSF2 Antibody (NBP2-47558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSF2 Products

Bioinformatics Tool for ACSF2 Antibody (NBP2-47558)

Discover related pathways, diseases and genes to ACSF2 Antibody (NBP2-47558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ACSF2 Antibody (NBP2-47558)

Find related products by research area.

Blogs on ACSF2

There are no specific blogs for ACSF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSF2