Recombinant Human ACBD4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ACBD4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-305 of Human ACBD4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR

Protein/Peptide Type
Recombinant Protein
Gene
ACBD4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACBD4 Protein

  • acyl-CoA binding domain containing 4
  • acyl-CoA-binding domain-containing protein 4
  • acyl-Coenzyme A binding domain containing 4
  • FLJ13322
  • FLJ90623

Background

This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13405
Species: Hu
Applications: IHC, IHC-P
H00064746-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-57602
Species: Hu
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00079777-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ACBD4 Recombinant Protein (H00079777-P01) (0)

There are no publications for ACBD4 Recombinant Protein (H00079777-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACBD4 Recombinant Protein (H00079777-P01) (0)

There are no reviews for ACBD4 Recombinant Protein (H00079777-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACBD4 Recombinant Protein (H00079777-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACBD4 Products

Bioinformatics Tool for ACBD4 Recombinant Protein (H00079777-P01)

Discover related pathways, diseases and genes to ACBD4 Recombinant Protein (H00079777-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBD4 Recombinant Protein (H00079777-P01)

Discover more about diseases related to ACBD4 Recombinant Protein (H00079777-P01).
 

Pathways for ACBD4 Recombinant Protein (H00079777-P01)

View related products by pathway.

Blogs on ACBD4

There are no specific blogs for ACBD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ACBD4 Antibody
NBP2-14258

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACBD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACBD4