We are going to order NBP1-79278 for Western Blot detection of Zebrafish embryonic Arrb2. Does this Ab also recognize Arrb1 due to their conserved sequences? Can you please tell me the exact peptide you used to generate the Ab for human ARRB2?

Name: beta-Arrestin 2 Antibody
Brand: Novus Biologicals
SKU: NBP1-79278
Price: 329 USD
Availability: Discontinued

Question

Accepted Answer

Unfortunately, our anti-hArrb2 antibody has not been tested for potential cross-reactivity to hArrb1. Based on the sequence of the peptide immunogen used to generate this anti-hARRB2 antibody, it is 100% homologous to all three isoforms of the human ARRB2 protein (https://www.uniprot.org/uniprotkb/P32121/entry) and 86% homologous to either isoform of the human ARRB1 protein (https://www.uniprot.org/uniprotkb/P49407/entry). Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Immunogen	Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL.
Predicted Species	Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Zebrafish (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ARRB2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	Immunohistochemistry 1 ug/ml Immunohistochemistry-Paraffin 4-8 ug/ml Western Blot 1:1000
Application Notes	This is a rabbit polyclonal antibody against ARRB2 and was validated on Western Blot and immunohistochemistry .
Theoretical MW	44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 2% Sucrose
Preservative	0.09% Sodium Azide
Purity	Immunogen affinity purified

Gene Symbol	ARRB2
Uniprot	NP_945355(Human)

beta-Arrestin 2 Antibody

Species Glossary

Images

Product Details

Order Details

beta-Arrestin 2 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for beta-Arrestin 2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for beta-Arrestin 2 Antibody (NBP1-79278) (0)

Reviews for beta-Arrestin 2 Antibody (NBP1-79278) (0)

Product General Protocols

Video Protocols

FAQs for beta-Arrestin 2 Antibody (NBP1-79278). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional beta-Arrestin 2 Products

Blogs on beta-Arrestin 2

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics