beta-Arrestin 2 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL. |
| Predicted Species |
Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Zebrafish (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ARRB2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1 ug/ml
- Immunohistochemistry-Paraffin 4-8 ug/ml
- Western Blot 1:1000
|
| Application Notes |
This is a rabbit polyclonal antibody against ARRB2 and was validated on Western Blot and immunohistochemistry . |
| Theoretical MW |
44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for beta-Arrestin 2 Antibody
Background
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Rt
Applications: IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ze
Applications: WB, IHC
Publications for beta-Arrestin 2 Antibody (NBP1-79278) (0)
There are no publications for beta-Arrestin 2 Antibody (NBP1-79278).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta-Arrestin 2 Antibody (NBP1-79278) (0)
There are no reviews for beta-Arrestin 2 Antibody (NBP1-79278).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for beta-Arrestin 2 Antibody (NBP1-79278). (Showing 1 - 1 of 1 FAQ).
-
We are going to order NBP1-79278 for Western Blot detection of Zebrafish embryonic Arrb2. Does this Ab also recognize Arrb1 due to their conserved sequences? Can you please tell me the exact peptide you used to generate the Ab for human ARRB2?
- Unfortunately, our anti-hArrb2 antibody has not been tested for potential cross-reactivity to hArrb1. Based on the sequence of the peptide immunogen used to generate this anti-hARRB2 antibody, it is 100% homologous to all three isoforms of the human ARRB2 protein (https://www.uniprot.org/uniprotkb/P32121/entry) and 86% homologous to either isoform of the human ARRB1 protein (https://www.uniprot.org/uniprotkb/P49407/entry). Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL.
Secondary Antibodies
| |
Isotype Controls
|
Additional beta-Arrestin 2 Products
Blogs on beta-Arrestin 2