ZNF852 Antibody


Western Blot: ZNF852 Antibody [NBP2-14804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ZNF852 Antibody [NBP2-14804] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

ZNF852 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
ZNF852 Protein (NBP2-14804PEP)

Alternate Names for ZNF852 Antibody

  • ZNF852 zinc finger protein 852


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF852 Antibody (NBP2-14804) (0)

There are no publications for ZNF852 Antibody (NBP2-14804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF852 Antibody (NBP2-14804) (0)

There are no reviews for ZNF852 Antibody (NBP2-14804). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF852 Antibody (NBP2-14804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF852 Antibody Products

Bioinformatics Tool for ZNF852 Antibody (NBP2-14804)

Discover related pathways, diseases and genes to ZNF852 Antibody (NBP2-14804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF852

There are no specific blogs for ZNF852, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol ZNF852

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14804 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought