ZNF688 Antibody


Western Blot: ZNF688 Antibody [NBP2-30749] - Analysis in control (vector only transfected HEK293T lysate) and ZNF688 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ZNF688 Antibody [NBP2-30749] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry: ZNF688 Antibody [NBP2-30749] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZNF688 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF688 Protein (NBP2-30749PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF688 Antibody

  • zinc finger protein 688


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF688 Antibody (NBP2-30749) (0)

There are no publications for ZNF688 Antibody (NBP2-30749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF688 Antibody (NBP2-30749) (0)

There are no reviews for ZNF688 Antibody (NBP2-30749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF688 Antibody (NBP2-30749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF688 Products

Bioinformatics Tool for ZNF688 Antibody (NBP2-30749)

Discover related pathways, diseases and genes to ZNF688 Antibody (NBP2-30749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF688

There are no specific blogs for ZNF688, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF688 Antibody and receive a gift card or discount.


Gene Symbol ZNF688