ZNF665 Antibody


Immunocytochemistry/ Immunofluorescence: ZNF665 Antibody [NBP2-13590] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: ZNF665 Antibody [NBP2-13590] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ZNF665 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VSLDISCKCVNTDLPPKGKNNMGEAFYTVKLERLESCDTVGLSFQEVQKN TYDFECQWKDD
Specificity of human ZNF665 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF665 Protein (NBP2-13590PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF665 Antibody

  • ZFP160L
  • zinc finger protein 665


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF665 Antibody (NBP2-13590) (0)

There are no publications for ZNF665 Antibody (NBP2-13590).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF665 Antibody (NBP2-13590) (0)

There are no reviews for ZNF665 Antibody (NBP2-13590). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF665 Antibody (NBP2-13590) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF665 Products

Bioinformatics Tool for ZNF665 Antibody (NBP2-13590)

Discover related pathways, diseases and genes to ZNF665 Antibody (NBP2-13590). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF665

There are no specific blogs for ZNF665, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF665 Antibody and receive a gift card or discount.


Gene Symbol ZNF665