ZNF598 Antibody (1E2)

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF598 Antibody (1E2) [H00090850-M11] - Analysis of monoclonal antibody to ZNF598 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: ZNF598 Antibody (1E2) [H00090850-M11] - Detection limit for recombinant GST tagged ZNF598 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, S-ELISA
Clone
1E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF598 Antibody (1E2) Summary

Immunogen
ZNF598 (NP_835461, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIPIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCPELP
Specificity
ZNF598 - zinc finger protein 598 (1E2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF598
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF598 Antibody (1E2)

  • DKFZp762F135
  • FLJ00086
  • zinc finger protein 598

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12812
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-03611
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H00090850-M11
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA

Publications for ZNF598 Antibody (H00090850-M11) (0)

There are no publications for ZNF598 Antibody (H00090850-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF598 Antibody (H00090850-M11) (0)

There are no reviews for ZNF598 Antibody (H00090850-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF598 Antibody (H00090850-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF598 Products

Bioinformatics Tool for ZNF598 Antibody (H00090850-M11)

Discover related pathways, diseases and genes to ZNF598 Antibody (H00090850-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZNF598 Antibody (H00090850-M11)

View related products by pathway.

Blogs on ZNF598

There are no specific blogs for ZNF598, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF598 Antibody (1E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF598
Entrez
Uniprot