ZNF510 Antibody

Images

 
Western Blot: ZNF510 Antibody [NBP2-13578] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ZNF510 Antibody [NBP2-13578] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & vesicles.
Immunohistochemistry-Paraffin: ZNF510 Antibody [NBP2-13578] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF510 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFN RKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF510
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF510 Protein (NBP2-13578PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF510 Antibody

  • BMZF-5FLJ58216
  • Bone marrow zinc finger 5
  • HD-ZNF1hematopoietic-derived zinc finger protein
  • Hematopoietic cell-derived zinc finger protein 1
  • zinc finger protein 254
  • Zinc finger protein 539ZNF539
  • Zinc finger protein 91-like
  • ZNF91LBMZF5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF510 Antibody (NBP2-13578) (0)

There are no publications for ZNF510 Antibody (NBP2-13578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF510 Antibody (NBP2-13578) (0)

There are no reviews for ZNF510 Antibody (NBP2-13578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF510 Antibody (NBP2-13578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF510 Products

Bioinformatics Tool for ZNF510 Antibody (NBP2-13578)

Discover related pathways, diseases and genes to ZNF510 Antibody (NBP2-13578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF510 Antibody (NBP2-13578)

Discover more about diseases related to ZNF510 Antibody (NBP2-13578).

Blogs on ZNF510

There are no specific blogs for ZNF510, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF510 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF510