![Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of U-2 OS cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF416-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05072-img0003.jpg "Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of U-2 OS cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit ZNF416 Antibody - Azide and BSA Free (NBP3-05072) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 495-594 of human ZNF416 (NP_060349.1). ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF416 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF416 |
![Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded human lung cancer using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ZNF416-Antibody-Immunohistochemistry-Paraffin-NBP3-05072-img0005.jpg "Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded human lung cancer using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of C6 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF416-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05072-img0001.jpg "Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of C6 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of NIH-3T3 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ZNF416-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05072-img0002.jpg "Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of NIH-3T3 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded rat pancreas using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ZNF416-Antibody-Immunohistochemistry-Paraffin-NBP3-05072-img0004.jpg "Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded rat pancreas using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded mouse brain using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ZNF416 Antibody-Immunohistochemistry-Paraffin-NBP3-05072-img0006.jpg "Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded mouse brain using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")