We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNF416 Antibody - Azide and BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of U-2 OS cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded human lung cancer using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen ...read more
Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of C6 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of NIH-3T3 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded rat pancreas using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded mouse brain using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ZNF416 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 495-594 of human ZNF416 (NP_060349.1). ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF416
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for ZNF416 Antibody - Azide and BSA Free

  • FLJ12859
  • FLJ14378
  • GC-box-binding zinc finger protein 1
  • GZP1
  • Transcription factor ZBP-99
  • ZBP99
  • ZBP-99
  • Zinc finger DNA-binding protein 99
  • zinc finger protein 281
  • ZNP-99 transcription factor
  • ZNP-99

Background

ZNF416 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for ZNF416 Antibody (NBP3-05072) (0)

There are no publications for ZNF416 Antibody (NBP3-05072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF416 Antibody (NBP3-05072) (0)

There are no reviews for ZNF416 Antibody (NBP3-05072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF416 Antibody (NBP3-05072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF416 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF416