ZNF213 Antibody

Immunocytochemistry/Immunofluorescence: ZNF213 Antibody [NBP2-58325] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZNF213 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF213
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF213 Recombinant Protein Antigen (NBP2-58325PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF213 Antibody

• zinc finger protein 213
• Zinc finger protein with KRAB and SCAN domains 21
• ZKSCAN21CR53Putative transcription factor CR53

Background

C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF213