Zmat2 Antibody

Images

 
Western Blot: Zmat2 Antibody [NBP2-83818] - WB Suggested Anti-ZMAT2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zmat2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Zmat2. Peptide sequence: KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Rabbit (100%), Guinea Pig (93%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZMAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zmat2 Antibody

  • hSNU23
  • matrin type 2
  • zinc finger, matrin-type 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32732
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89024
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16130
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Zmat2 Antibody (NBP2-83818) (0)

There are no publications for Zmat2 Antibody (NBP2-83818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zmat2 Antibody (NBP2-83818) (0)

There are no reviews for Zmat2 Antibody (NBP2-83818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zmat2 Antibody (NBP2-83818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Zmat2 Products

Bioinformatics Tool for Zmat2 Antibody (NBP2-83818)

Discover related pathways, diseases and genes to Zmat2 Antibody (NBP2-83818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Zmat2

There are no specific blogs for Zmat2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zmat2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMAT2