ZKSCAN2 Antibody

Immunohistochemistry-Paraffin: ZKSCAN2 Antibody [NBP2-13549] Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

ZKSCAN2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VVHLEKETGRLRQQVSSPVHREKHSPLGAAWEVADFQPEQVETQPRAVSR EEPGSLHSGHQEQLNRKRERR
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
40% glycerol and PBS pH 7.2.
0.02% Sodium Azide
Immunogen affinity purified

Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
ZKSCAN2 Protein (NBP2-13549PEP)

Alternate Names for ZKSCAN2 Antibody

  • zinc finger protein with KRAB and SCAN domains 2
  • zinc finger with KRAB and SCAN domains 2
  • ZNF694
  • ZSCAN31

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZKSCAN2 Antibody (NBP2-13549) (0)

There are no publications for ZKSCAN2 Antibody (NBP2-13549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZKSCAN2 Antibody (NBP2-13549) (0)

There are no reviews for ZKSCAN2 Antibody (NBP2-13549). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZKSCAN2 Antibody (NBP2-13549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional ZKSCAN2 Antibody Products

Bioinformatics Tool for ZKSCAN2 Antibody (NBP2-13549)

Discover related pathways, diseases and genes to ZKSCAN2 Antibody (NBP2-13549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZKSCAN2

There are no specific blogs for ZKSCAN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Gene Symbol ZKSCAN2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13549 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought