![Western Blot: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-652](http://images.novusbio.com/fullsize/Zinc-finger-and-BTB-domain-containing-protein-9-Antibody-Western-Blot-NBP1-92611-img0005.jpg "Western Blot: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-652")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Zinc finger and BTB domain-containing protein 9 Antibody - BSA Free (NBP1-92611) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Zinc finger and BTB domain-containing protein 9 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZBTB9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Zinc finger and BTB domain-containing protein 9 Antibody (NBP1-92611)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZBTB9 |
![Immunocytochemistry/Immunofluorescence: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & mitochondria.](http://images.novusbio.com/fullsize/Zinc-finger-and-BTB-domain-containing-protein-9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92611-img0006.jpg "Immunocytochemistry/Immunofluorescence: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & mitochondria.")
![Immunohistochemistry-Paraffin: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://images.novusbio.com/fullsize/Zinc-finger-and-BTB-domain-containing-protein-9-Antibody-Immunohistochemistry-Paraffin-NBP1-92611-img0002.jpg "Immunohistochemistry-Paraffin: Zinc finger and BTB domain-containing protein 9 Antibody [NBP1-92611] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.")
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/nbp1-92611_rabbit-polyclonal-zinc-finger-and-btb-domain-containing-protein-9-antibody-29520251615556.jpg "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")