ZGRF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C4orf21/prematurely terminated mRNA decay factor-like Antibody [NBP2-48596] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: C4orf21/prematurely terminated mRNA decay factor-like Antibody [NBP2-48596] - Staining of human placenta shows cytoplasmic and membranous positivity in decidual cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZGRF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CDGPKADRCKFFKWLEDVTPGYSTQEGARPGMVLSDIKSIGLYLRSQKIPLYEECQLLVRKGFDFQRKQYGKLKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4ORF21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZGRF1 Recombinant Protein Antigen (NBP2-48596PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZGRF1 Antibody

  • chromosome 4 open reading frame 21
  • DKFZp313L226
  • DKFZp434C0927

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZGRF1 Antibody (NBP2-48596) (0)

There are no publications for ZGRF1 Antibody (NBP2-48596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZGRF1 Antibody (NBP2-48596) (0)

There are no reviews for ZGRF1 Antibody (NBP2-48596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZGRF1 Antibody (NBP2-48596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZGRF1 Products

Array NBP2-48596

Bioinformatics Tool for ZGRF1 Antibody (NBP2-48596)

Discover related pathways, diseases and genes to ZGRF1 Antibody (NBP2-48596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZGRF1

There are no specific blogs for ZGRF1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZGRF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4ORF21