Recombinant Human ZFAND2B Protein

Images

 
SDS-Page: Recombinant Human ZFAND2B Protein [H00130617-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human ZFAND2B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 257 of Human ZFAND2B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZFAND2B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFAND2B Protein

  • AIRAP-like protein
  • AN1-type 2B
  • AN1-type zinc finger protein 2B
  • arsenite inducible RNA associated protein-like
  • Arsenite-inducible RNA-associated protein-like protein
  • zinc finger, AN1-type domain 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-49637
Species: Hu
Applications: WB, IHC
NBP1-90864
Species: Hu
Applications: WB, IHC, IHC-P
H00130617-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for ZFAND2B Recombinant Protein (H00130617-P01) (0)

There are no publications for ZFAND2B Recombinant Protein (H00130617-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFAND2B Recombinant Protein (H00130617-P01) (0)

There are no reviews for ZFAND2B Recombinant Protein (H00130617-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFAND2B Recombinant Protein (H00130617-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFAND2B Products

Bioinformatics Tool for ZFAND2B Recombinant Protein (H00130617-P01)

Discover related pathways, diseases and genes to ZFAND2B Recombinant Protein (H00130617-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFAND2B Recombinant Protein (H00130617-P01)

Discover more about diseases related to ZFAND2B Recombinant Protein (H00130617-P01).

PTMs for ZFAND2B Recombinant Protein (H00130617-P01)

Learn more about PTMs related to ZFAND2B Recombinant Protein (H00130617-P01).

Blogs on ZFAND2B

There are no specific blogs for ZFAND2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZFAND2B Antibody
NBP1-89174

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFAND2B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFAND2B