![Western Blot: ZFAND1 Antibody [NBP1-82242] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Western-Blot-NBP1-82242-img0005.jpg "Western Blot: ZFAND1 Antibody [NBP1-82242] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCAERELVAVICP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZFAND1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZFAND1 |
![Immunocytochemistry/Immunofluorescence: ZFAND1 Antibody [NBP1-82242] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82242-img0006.jpg "Immunocytochemistry/Immunofluorescence: ZFAND1 Antibody [NBP1-82242] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Immunohistochemistry-Paraffin-NBP1-82242-img0011.jpg "Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Immunohistochemistry-Paraffin-NBP1-82242-img0007.jpg "Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.")
![Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Immunohistochemistry-Paraffin-NBP1-82242-img0008.jpg "Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/ZFAND1-Antibody-Immunohistochemistry-Paraffin-NBP1-82242-img0009.jpg "Immunohistochemistry-Paraffin: ZFAND1 Antibody [NBP1-82242] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")