XTP12 Antibody


Western Blot: XTP12 Antibody [NBP1-90533] - Analysis in control (vector only transfected HEK293T lysate) and C6orf62 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: XTP12 Antibody [NBP1-90533] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: XTP12 Antibody [NBP1-90533] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

XTP12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQLTHWAVGTIEDHLRPYMPE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XTP12 Protein (NBP1-90533PEP)
Read Publication using NBP1-90533.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for XTP12 Antibody

  • C6orf62
  • chromosome 6 open reading frame 62
  • dJ30M3.2
  • HBV X-transactivated protein 12
  • Nbla00237


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XTP12 Antibody (NBP1-90533)(1)

Reviews for XTP12 Antibody (NBP1-90533) (0)

There are no reviews for XTP12 Antibody (NBP1-90533). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XTP12 Antibody (NBP1-90533) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional XTP12 Products

Bioinformatics Tool for XTP12 Antibody (NBP1-90533)

Discover related pathways, diseases and genes to XTP12 Antibody (NBP1-90533). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on XTP12

There are no specific blogs for XTP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XTP12 Antibody and receive a gift card or discount.


Gene Symbol C6ORF62