Novus Biologicals products are now on bio-techne.com

WWC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WWC3 Antibody [NBP1-90755] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: WWC3 Antibody [NBP1-90755] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WWC3 Antibody [NBP1-90755] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Immunohistochemistry-Paraffin: WWC3 Antibody [NBP1-90755] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: WWC3 Antibody [NBP1-90755] - Staining of human skin shows moderate granular cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WWC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WWC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WWC3 Protein (NBP1-90755PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WWC3 Antibody

  • BM042
  • KIAA1280
  • protein WWC3
  • WWC family member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WWC3 Antibody (NBP1-90755) (0)

There are no publications for WWC3 Antibody (NBP1-90755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WWC3 Antibody (NBP1-90755) (0)

There are no reviews for WWC3 Antibody (NBP1-90755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WWC3 Antibody (NBP1-90755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WWC3 Products

Array NBP1-90755

Research Areas for WWC3 Antibody (NBP1-90755)

Find related products by research area.

Blogs on WWC3

There are no specific blogs for WWC3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WWC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WWC3