WW domain binding protein 5 Recombinant Protein Antigen

Images

 
There are currently no images for WW domain binding protein 5 Protein (NBP1-84208PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WW domain binding protein 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WBP5.

Source: E. coli

Amino Acid Sequence: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TCEAL9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84208.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WW domain binding protein 5 Recombinant Protein Antigen

  • DKFZp313K1940
  • N4
  • NDFIP1
  • pp21 homolog
  • TCEAL9
  • WBP-5
  • WW domain binding protein 1
  • WW domain binding protein 5
  • WW domain-binding protein 5

Background

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-31660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56146
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for WW domain binding protein 5 Protein (NBP1-84208PEP) (0)

There are no publications for WW domain binding protein 5 Protein (NBP1-84208PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WW domain binding protein 5 Protein (NBP1-84208PEP) (0)

There are no reviews for WW domain binding protein 5 Protein (NBP1-84208PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WW domain binding protein 5 Protein (NBP1-84208PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WW domain binding protein 5 Products

Research Areas for WW domain binding protein 5 Protein (NBP1-84208PEP)

Find related products by research area.

Blogs on WW domain binding protein 5

There are no specific blogs for WW domain binding protein 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WW domain binding protein 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEAL9