WFDC3 Antibody (5C12)

Images

 
Sandwich ELISA: WFDC3 Antibody (5C12) [H00140686-M03] - Detection limit for recombinant GST tagged WFDC3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WFDC3 Antibody (5C12) Summary

Immunogen
WFDC3 (AAH26014.2, 1 a.a. ~ 48 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WFDC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WFDC3 Antibody (5C12)

  • WAP four-disulfide core domain 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1747
Species: Hu
Applications: ELISA
NBP2-51521
Species: Hu
Applications: PAGE
NBP2-50363
Species: Hu
Applications: ELISA, IHC, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-05629
Species: Hu, Mu, Rt
Applications: WB
DHE400
Species: Hu
Applications: ELISA

Publications for WFDC3 Antibody (H00140686-M03) (0)

There are no publications for WFDC3 Antibody (H00140686-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WFDC3 Antibody (H00140686-M03) (0)

There are no reviews for WFDC3 Antibody (H00140686-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WFDC3 Antibody (H00140686-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WFDC3 Products

Bioinformatics Tool for WFDC3 Antibody (H00140686-M03)

Discover related pathways, diseases and genes to WFDC3 Antibody (H00140686-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFDC3 Antibody (H00140686-M03)

Discover more about diseases related to WFDC3 Antibody (H00140686-M03).

Blogs on WFDC3

There are no specific blogs for WFDC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WFDC3 Antibody (5C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC3
Uniprot