![Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 expression in human brain and NCS cells. Immunoblot of WDR73 from NHDFs and dermal fibroblasts from a heterozygous (WDR73 +/p.Phe296Leufs*26) parent of a child with NCS. Note the additional lower molecular mass band for the truncated WDR73 in the heterozygous parent's cell lysate. Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/WDR73-Antibody-Western-Blot-NBP1-82219-img0010.jpg "Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 expression in human brain and NCS cells. Immunoblot of WDR73 from NHDFs and dermal fibroblasts from a heterozygous (WDR73 +/p.Phe296Leufs*26) parent of a child with NCS. Note the additional lower molecular mass band for the truncated WDR73 in the heterozygous parent's cell lysate. Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR73 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB, ICC/IF, IHC-P reported in scientific literature (PMID: 26070982). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82219 | Applications | Species |
|---|---|---|
| Jinks RN, Puffenberger EG, Baple E et al. Recessive nephrocerebellar syndrome on the Galloway-Mowat syndrome spectrum is caused by homozygous protein-truncating mutations of WDR73 Brain. 2015-06-11 [PMID: 26070982] (ICC/IF, IHC-P, WB, Human) | ICC/IF, IHC-P, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR73 |
![Immunocytochemistry/Immunofluorescence: WDR73 Antibody [NBP1-82219] - WDR73 immunoreactivity in fibroblasts from a child with NCS & a heterozygous parent. (A) Anti-WDR73 (green) immunoreactivity is diffuse & cytosolic during interphase (anti-alpha-tubulin, red). (B) WDR73 immunoreactivity localizes to spindle poles & spindle microtubules during metaphase. (C) WDR73 immunoreactivity at mitotic spindle poles, kinetochore microtubules & central spindle microtubules during anaphase. (D) WDR73 immunoreactivity localizes to midbody microtubules apposing the Flemming body. (E-H) WDR73 immunoreactivity is weak and cytosolic in NCS fibroblasts homozygous for WDR73. (E and F) 22% of NCS fibroblasts were binucleate & an additional 20% displayed abnormal nuclear morphology. Scale bars: 10 um (A-D); 50 um (E-F). Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/WDR73-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82219-img0007.jpg "Immunocytochemistry/Immunofluorescence: WDR73 Antibody [NBP1-82219] - WDR73 immunoreactivity in fibroblasts from a child with NCS & a heterozygous parent. (A) Anti-WDR73 (green) immunoreactivity is diffuse & cytosolic during interphase (anti-alpha-tubulin, red). (B) WDR73 immunoreactivity localizes to spindle poles & spindle microtubules during metaphase. (C) WDR73 immunoreactivity at mitotic spindle poles, kinetochore microtubules & central spindle microtubules during anaphase. (D) WDR73 immunoreactivity localizes to midbody microtubules apposing the Flemming body. (E-H) WDR73 immunoreactivity is weak and cytosolic in NCS fibroblasts homozygous for WDR73. (E and F) 22% of NCS fibroblasts were binucleate & an additional 20% displayed abnormal nuclear morphology. Scale bars: 10 um (A-D); 50 um (E-F). Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: WDR73 Antibody [NBP1-82219] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR73-Antibody-Immunohistochemistry-Paraffin-NBP1-82219-img0002.jpg "Immunohistochemistry-Paraffin: WDR73 Antibody [NBP1-82219] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: WDR73 Antibody [NBP1-82219] - Analysis in control (vector only transfected HEK293T lysate) and wDR73 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/WDR73-Antibody-Western-Blot-NBP1-82219-img0006.jpg "Western Blot: WDR73 Antibody [NBP1-82219] - Analysis in control (vector only transfected HEK293T lysate) and wDR73 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 expression in human brain and NCS cells. Immunoblot of WDR73 expression in: lanes 1 and 2, normal post-mortem human cerebellum, cerebral cortex; lanes 3-5, cultured human cells as indicated. Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/WDR73-Antibody-Western-Blot-NBP1-82219-img0009.jpg "Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 expression in human brain and NCS cells. Immunoblot of WDR73 expression in: lanes 1 and 2, normal post-mortem human cerebellum, cerebral cortex; lanes 3-5, cultured human cells as indicated. Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.")
![Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 interacts with alpha-, beta-, and gamma-tubulin, CAD, HSP-70, HSP-90, and p70 S6 kinase. Lentiviral transduction of shRNA plasmid constructs A and B targeting WDR73 in HEK-293FT cells successfully knocked down WDR73 and produced a concomitant decrease in ribosomal protein S6 phosphorylation. GAPDH was labelled as a protein loading control. This immunoblot was labelled with the same anti-WDR73 antibody (Novus) used for immunoblotting throughout the paper (validating the specificity of the antibody). Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/WDR73-Antibody-Knockdown-Validated-NBP1-82219-img0008.jpg "Western Blot: WDR73 Antibody [NBP1-82219] - WDR73 interacts with alpha-, beta-, and gamma-tubulin, CAD, HSP-70, HSP-90, and p70 S6 kinase. Lentiviral transduction of shRNA plasmid constructs A and B targeting WDR73 in HEK-293FT cells successfully knocked down WDR73 and produced a concomitant decrease in ribosomal protein S6 phosphorylation. GAPDH was labelled as a protein loading control. This immunoblot was labelled with the same anti-WDR73 antibody (Novus) used for immunoblotting throughout the paper (validating the specificity of the antibody). Image collected and cropped by CiteAb from the following publication (//academic.oup.com/brain/article-lookup/doi/10.1093/brain/awv153), licensed under a CC-BY license.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")