WDR60 Antibody

Immunocytochemistry/Immunofluorescence: WDR60 Antibody [NBP1-90437] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WDR60 Antibody [NBP1-90437] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Knockout Validated: WDR60 Antibody [NBP1-90437] - HA-WDR34 (NBP1-88805) and HA-WDR60 (NBP1-90437) expression in WT and KO cells. (A) Pull down of HA-WDR60 in WT and WDR34 KO cells. HA-WDR60 pulls down WDR34 in WT but not in KO cells (B) Pull down of HA-WDR34 in WT and WDR60 KO cells. HA-WDR34 pulls down WDR60 in WT but not in KO cells. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30320547/) licensed under a CC-BY licence.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

WDR60 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR60
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
  • Knockdown Validated
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. Use in IP, WB, KD reported in scientific literature (PMID:30320547).
• Control Peptide:

  WDR60 Protein (NBP1-90437PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25205765).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR60 Antibody

• FLJ10300
• FLJ23575
• WD repeat domain 60
• WD repeat-containing protein 60

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR60 Antibody (NBP1-90437)(2)

Publications using NBP1-90437

• Vuolo Laura, Stevenson Nicola L, Heesom Kate J, Stephens David J Dynein-2 intermediate chains play crucial but distinct roles in primary cilia formation and function. International Immunology 2018-10-16 [PMID: 30320547] (IP, KD, WB, Human)
• Asante D, Stevenson NL, Stephens DJ. Subunit composition of the human cytoplasmic dynein-2 complex. J Cell Sci 2014-11-01 [PMID: 25205765] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: WDR60