![Western Blot: WDR53 Antibody [NBP1-82758] - Analysis using Anti-WDR53 antibody NBP1-82758 (A) shows similar pattern to independent antibody NBP1-82757 (B).](http://images.novusbio.com/fullsize/WDR53-Antibody-Western-Blot-NBP1-82758-img0007.jpg "Western Blot: WDR53 Antibody [NBP1-82758] - Analysis using Anti-WDR53 antibody NBP1-82758 (A) shows similar pattern to independent antibody NBP1-82757 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit WDR53 Antibody - BSA Free (NBP1-82758) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-WDR53 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR53 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82758 | Applications | Species |
|---|---|---|
| Rutkowski TP, Purcell RH, Pollak RM, et al. Behavioral changes and growth deficits in a CRISPR engineered mouse model of the schizophrenia-associated 3q29 deletion Mol. Psychiatry 2019-04-11 [PMID: 30976085] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR53 |
![Immunocytochemistry/Immunofluorescence: WDR53 Antibody [NBP1-82758] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/WDR53-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82758-img0006.jpg "Immunocytochemistry/Immunofluorescence: WDR53 Antibody [NBP1-82758] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: WDR53 Antibody [NBP1-82758] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR53-Antibody-Immunohistochemistry-Paraffin-NBP1-82758-img0001.jpg "Immunohistochemistry-Paraffin: WDR53 Antibody [NBP1-82758] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.")
![Western Blot: WDR53 Antibody [NBP1-82758] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/WDR53-Antibody-Western-Blot-NBP1-82758-img0003.jpg "Western Blot: WDR53 Antibody [NBP1-82758] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")