We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WDR33 Antibody - BSA Free

Images

 
Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

WDR33 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR33
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for WDR33 Antibody - BSA Free

  • NET14
  • WD repeat domain 33
  • WD repeat-containing protein 33
  • WD repeat-containing protein WDC146
  • WDC146FLJ11294

Background

WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P

Publications for WDR33 Antibody (NBP1-60030) (0)

There are no publications for WDR33 Antibody (NBP1-60030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR33 Antibody (NBP1-60030) (0)

There are no reviews for WDR33 Antibody (NBP1-60030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR33 Antibody (NBP1-60030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR33 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR33
Uniprot