WDR33 Antibody

Images

 
Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR33 Antibody Summary

Immunogen
Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WDR33 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WDR33 Antibody

  • NET14
  • WD repeat domain 33
  • WD repeat-containing protein 33
  • WD repeat-containing protein WDC146
  • WDC146FLJ11294

Background

WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for WDR33 Antibody (NBP1-60030) (0)

There are no publications for WDR33 Antibody (NBP1-60030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR33 Antibody (NBP1-60030) (0)

There are no reviews for WDR33 Antibody (NBP1-60030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR33 Antibody (NBP1-60030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR33 Products

Array NBP1-60030

Bioinformatics Tool for WDR33 Antibody (NBP1-60030)

Discover related pathways, diseases and genes to WDR33 Antibody (NBP1-60030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for WDR33 Antibody (NBP1-60030)

View related products by pathway.

Blogs on WDR33

There are no specific blogs for WDR33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR33
Uniprot