WDR33 Antibody - BSA Free

Western Blot: WDR33 Antibody [NBP1-60030] - Human HepG2, Antibody Dilution: 1.0 ug/ml WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.

Western Blot: WDR33 Antibody [NBP1-60030] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: WDR33 Antibody [NBP1-60030] - Lanes: 1 : SREC pulldown from lysate from 10^6 human 293T cells Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa Fluor Secondary, Antibody Dilution: 1 : 5000 Gene name: WDR33.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WDR33 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WDR33 Antibody - BSA Free

• NET14
• WD repeat domain 33
• WD repeat-containing protein 33
• WD repeat-containing protein WDC146
• WDC146FLJ11294

Background

WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR33
• Uniprot:
  • Q6NUQ0(Human)