VSIG10 Antibody


Immunocytochemistry/ Immunofluorescence: VSIG10 Antibody [NBP2-68783] - Staining of human cell line SiHa shows localization to cytosol & microtubule organizing center.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

VSIG10 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
VSIG10 Recombinant Protein Antigen (NBP2-68783PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for VSIG10 Antibody

  • FLJ20674
  • V-set and immunoglobulin domain containing 10
  • V-set and immunoglobulin domain-containing protein 10
  • VSIG10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VSIG10 Antibody (NBP2-68783) (0)

There are no publications for VSIG10 Antibody (NBP2-68783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSIG10 Antibody (NBP2-68783) (0)

There are no reviews for VSIG10 Antibody (NBP2-68783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VSIG10 Antibody (NBP2-68783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional VSIG10 Products

Bioinformatics Tool for VSIG10 Antibody (NBP2-68783)

Discover related pathways, diseases and genes to VSIG10 Antibody (NBP2-68783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VSIG10

There are no specific blogs for VSIG10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VSIG10 Antibody and receive a gift card or discount.


Gene Symbol VSIG10