TVP23A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TVP23A Antibody [NBP2-32556] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry-Paraffin: TVP23A Antibody [NBP2-32556] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TVP23A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TVP23A Protein (NBP2-32556PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TVP23A Antibody

  • FAM18A
  • Family With Sequence Similarity 18, Member A
  • Golgi Apparatus Membrane Protein TVP23 Homolog A
  • Protein FAM18A
  • Trans-Golgi Network Vesicle Protein 23 Homolog A (S. Cerevisiae)
  • YDR084C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TVP23A Antibody (NBP2-32556) (0)

There are no publications for TVP23A Antibody (NBP2-32556).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TVP23A Antibody (NBP2-32556) (0)

There are no reviews for TVP23A Antibody (NBP2-32556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TVP23A Antibody (NBP2-32556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TVP23A Antibody and receive a gift card or discount.