TTC39C Antibody


Western Blot: TTC39C Antibody [NBP2-56001] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: TTC39C Antibody [NBP2-56001] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

TTC39C Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ
Specificity of human TTC39C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC39C Recombinant Protein Antigen (NBP2-56001PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TTC39C Antibody

  • C18orf17
  • Chromosome 18 Open Reading Frame 17
  • HsT2697
  • Tetratricopeptide Repeat Domain 39C
  • TPR Repeat Protein 39C


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC39C Antibody (NBP2-56001) (0)

There are no publications for TTC39C Antibody (NBP2-56001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC39C Antibody (NBP2-56001) (0)

There are no reviews for TTC39C Antibody (NBP2-56001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC39C Antibody (NBP2-56001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TTC39C Products

Bioinformatics Tool for TTC39C Antibody (NBP2-56001)

Discover related pathways, diseases and genes to TTC39C Antibody (NBP2-56001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC39C

There are no specific blogs for TTC39C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC39C Antibody and receive a gift card or discount.


Gene Symbol TTC39C