TTC39C Antibody

Images

 
Western Blot: TTC39C Antibody [NBP2-49458] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunohistochemistry: TTC39C Antibody [NBP2-49458] - Staining of human stomach shows moderate nuclear membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC39C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:TSFHTALELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKRKNNQIEQFSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC39C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:500 - 1:1000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
TTC39C Recombinant Protein Antigen (NBP2-49458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC39C Antibody

  • C18orf17
  • Chromosome 18 Open Reading Frame 17
  • HsT2697
  • Tetratricopeptide Repeat Domain 39C
  • TPR Repeat Protein 39C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC39C Antibody (NBP2-49458) (0)

There are no publications for TTC39C Antibody (NBP2-49458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC39C Antibody (NBP2-49458) (0)

There are no reviews for TTC39C Antibody (NBP2-49458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC39C Antibody (NBP2-49458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC39C Products

Bioinformatics Tool for TTC39C Antibody (NBP2-49458)

Discover related pathways, diseases and genes to TTC39C Antibody (NBP2-49458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC39C

There are no specific blogs for TTC39C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC39C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC39C