TTC18 Antibody


Immunohistochemistry: TTC18 Antibody [NBP2-32689] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TTC18 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ
Specificity of human TTC18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTC18 Protein (NBP2-32689PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TTC18 Antibody

  • FLJ12173
  • FLJ25765
  • RP11-152N13.6
  • tetratricopeptide repeat domain 18
  • tetratricopeptide repeat protein 18
  • tetratricopeptide repeat-containing protein
  • TPR repeat protein 18


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC18 Antibody (NBP2-32689) (0)

There are no publications for TTC18 Antibody (NBP2-32689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC18 Antibody (NBP2-32689) (0)

There are no reviews for TTC18 Antibody (NBP2-32689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC18 Antibody (NBP2-32689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TTC18 Products

Bioinformatics Tool for TTC18 Antibody (NBP2-32689)

Discover related pathways, diseases and genes to TTC18 Antibody (NBP2-32689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC18

There are no specific blogs for TTC18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC18 Antibody and receive a gift card or discount.


Gene Symbol TTC18