Recombinant Human TSEN34 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TSEN34 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 99 of Human TSEN34 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA

Protein/Peptide Type
Partial Recombinant Protein
Gene
TSEN34

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSEN34 Protein

  • EC 3.1.27.9
  • hsSen34
  • leukocyte receptor cluster (LRC) member 5
  • Leukocyte receptor cluster member 5
  • PCH2C
  • SEN34LENG5SEN34L
  • tRNA splicing endonuclease 34 homolog (S. cerevisiae)
  • tRNA splicing endonuclease 34 homolog (SEN34, S. cerevisiae)
  • tRNA-intron endonuclease Sen34
  • tRNA-splicing endonuclease subunit Sen34

Background

TSEN34 - tRNA splicing endonuclease 34 homolog (SEN34, S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TSEN34 Partial Recombinant Protein (H00079042-Q01) (0)

There are no publications for TSEN34 Partial Recombinant Protein (H00079042-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSEN34 Partial Recombinant Protein (H00079042-Q01) (0)

There are no reviews for TSEN34 Partial Recombinant Protein (H00079042-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSEN34 Partial Recombinant Protein (H00079042-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSEN34 Products

Bioinformatics Tool for TSEN34 Partial Recombinant Protein (H00079042-Q01)

Discover related pathways, diseases and genes to TSEN34 Partial Recombinant Protein (H00079042-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSEN34 Partial Recombinant Protein (H00079042-Q01)

Discover more about diseases related to TSEN34 Partial Recombinant Protein (H00079042-Q01).
 

Pathways for TSEN34 Partial Recombinant Protein (H00079042-Q01)

View related products by pathway.

Blogs on TSEN34

There are no specific blogs for TSEN34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TSEN34 Antibody
H00079042-B01
sen15 Antibody
NBP1-89888

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSEN34 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSEN34