TSC21 Antibody


Western Blot: TSC21 Antibody [NBP1-91727] - Analysis in control (vector only transfected HEK293T lysate) and TEX37 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining in human testis and endometrium tissues using anti-TEX37 antibody. Corresponding TEX37 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

TSC21 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
Specificity of human TSC21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSC21 Protein (NBP1-91727PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TSC21 Antibody

  • chromosome 2 open reading frame 51
  • FLJ25369
  • protein TSC21
  • Testis-specific conserved protein of 21 kDa
  • TSC21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSC21 Antibody (NBP1-91727) (0)

There are no publications for TSC21 Antibody (NBP1-91727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSC21 Antibody (NBP1-91727) (0)

There are no reviews for TSC21 Antibody (NBP1-91727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSC21 Antibody (NBP1-91727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TSC21 Products

Bioinformatics Tool for TSC21 Antibody (NBP1-91727)

Discover related pathways, diseases and genes to TSC21 Antibody (NBP1-91727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TSC21

There are no specific blogs for TSC21, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TSC21 Antibody and receive a gift card or discount.


Gene Symbol TEX37