TSC21 Antibody

Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining in human testis and endometrium tissues using anti-TEX37 antibody. Corresponding TEX37 RNA-seq data are presented for the same tissues.

Western Blot: TSC21 Antibody [NBP1-91727] - Analysis in control (vector only transfected HEK293T lysate) and TEX37 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: TSC21 Antibody [NBP1-91727] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TSC21 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEX37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TSC21 Protein (NBP1-91727PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSC21 Antibody

• chromosome 2 open reading frame 51
• FLJ25369
• protein TSC21
• Testis-specific conserved protein of 21 kDa
• TSC21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEX37