TRMT1L Antibody


Western Blot: TRMT1L Antibody [NBP1-79968] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TRMT1L Antibody Summary

Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C1ORF25 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRMT1L Antibody

  • C1orf25MST070
  • chromosome 1 open reading frame 25
  • MGC25112
  • MGC57134
  • TRM1 tRNA methyltransferase 1-like
  • TRM1LbG120K12.3
  • TRM1-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB

Publications for TRMT1L Antibody (NBP1-79968) (0)

There are no publications for TRMT1L Antibody (NBP1-79968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT1L Antibody (NBP1-79968) (0)

There are no reviews for TRMT1L Antibody (NBP1-79968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRMT1L Antibody (NBP1-79968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRMT1L Products

Bioinformatics Tool for TRMT1L Antibody (NBP1-79968)

Discover related pathways, diseases and genes to TRMT1L Antibody (NBP1-79968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRMT1L Antibody (NBP1-79968)

Discover more about diseases related to TRMT1L Antibody (NBP1-79968).

Pathways for TRMT1L Antibody (NBP1-79968)

View related products by pathway.

Blogs on TRMT1L

There are no specific blogs for TRMT1L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRMT1L Antibody and receive a gift card or discount.


Gene Symbol TRMT1L