![Immunocytochemistry/Immunofluorescence: Trinucleotide Repeat Containing 18 Antibody [NBP2-30890] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nuclear membrane, cytosol & mitochondria.](http://images.novusbio.com/fullsize2/Trinucleotide Repeat Containing 18 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30890-img0004.jpg "Immunocytochemistry/Immunofluorescence: Trinucleotide Repeat Containing 18 Antibody [NBP2-30890] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nuclear membrane, cytosol & mitochondria.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTLEMSDCDVPAGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLPSPGAAGAQALEKLEAAESLVLEQSFLHGIT |
| Specificity | Specificity of human Trinucleotide Repeat Containing 18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNRC18 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Trinucleotide Repeat Containing 18 Antibody [NBP2-30890] - Staining of human placenta shows nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/Trinucleotide-Repeat-Containing-18-Antibody-Immunohistochemistry-Paraffin-NBP2-30890-img0003.jpg "Immunohistochemistry-Paraffin: Trinucleotide Repeat Containing 18 Antibody [NBP2-30890] - Staining of human placenta shows nuclear and cytoplasmic positivity in trophoblastic cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")