TRAPPC6B Antibody


Western Blot: TRAPPC6B Antibody [NBP1-70736] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TRAPPC6B Antibody Summary

Synthetic peptides corresponding to TRAPPC6B(trafficking protein particle complex 6B) The peptide sequence was selected from the middle region of TRAPPC6B. Peptide sequence TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF.
This product is specific to Subunit or Isoform: 6B.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRAPPC6B and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRAPPC6B Antibody

  • FLJ17772
  • FLJ79549
  • TPC6
  • trafficking protein particle complex 6B


TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport (Kummel et al., 2005 [PubMed 16025134]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for TRAPPC6B Antibody (NBP1-70736) (0)

There are no publications for TRAPPC6B Antibody (NBP1-70736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAPPC6B Antibody (NBP1-70736) (0)

There are no reviews for TRAPPC6B Antibody (NBP1-70736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAPPC6B Antibody (NBP1-70736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRAPPC6B Products

Bioinformatics Tool for TRAPPC6B Antibody (NBP1-70736)

Discover related pathways, diseases and genes to TRAPPC6B Antibody (NBP1-70736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TRAPPC6B Antibody (NBP1-70736)

View related products by pathway.

Blogs on TRAPPC6B

There are no specific blogs for TRAPPC6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRAPPC6B Antibody and receive a gift card or discount.


Gene Symbol TRAPPC6B