Recombinant Human TPD52L3/D55 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human TPD52L3/D55 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 140 of Human TPD52L3 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGLMGTIKSKVSGGKRAWP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: TPD52L3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 41.9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TPD52L3/D55 GST (N-Term) Protein

• hD55
• MGC26757
• NYDSP25
• NYD-SP25
• protein kinase NYD-SP25
• Testis development protein NYD-SP25
• tumor protein D52-like 3MGC45374
• tumor protein D55

Background

The Tumor protein D52 like 3 gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by anN-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-likeproteins. The encoded pro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPD52L3