TOP6BL Antibody

Images

 
Immunohistochemistry: C11orf80 Antibody [NBP2-38433] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOP6BL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLADTSGQA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11orf80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOP6BL Recombinant Protein Antigen (NBP2-38433PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOP6BL Antibody

  • C11orf80
  • chromosome 11 open reading frame 80
  • FLJ22531

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOP6BL Antibody (NBP2-38433) (0)

There are no publications for TOP6BL Antibody (NBP2-38433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOP6BL Antibody (NBP2-38433) (0)

There are no reviews for TOP6BL Antibody (NBP2-38433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TOP6BL Antibody (NBP2-38433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOP6BL Products

Bioinformatics Tool for TOP6BL Antibody (NBP2-38433)

Discover related pathways, diseases and genes to TOP6BL Antibody (NBP2-38433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for TOP6BL Antibody (NBP2-38433)

Learn more about PTMs related to TOP6BL Antibody (NBP2-38433).

Blogs on TOP6BL

There are no specific blogs for TOP6BL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOP6BL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11orf80