TMEM90A Antibody

Images

 
Immunohistochemistry: TMEM90A Antibody [NBP2-30935] - Staining of human adrenal gland shows distinct nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM90A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEESDATSTESESEDNFLTLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNDIG1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM90A Protein (NBP2-30935PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM90A Antibody

  • CAPUCIN
  • Caudate- And Putamen-Enriched Sequence
  • Caudate-And Putamen-Enriched Sequence
  • Dispanin Subfamily C Member 1
  • DSPC1
  • IFITMD4
  • Interferon Induced Transmembrane Protein Domain Containing 4
  • Synapse Differentiation Inducing 1-Like
  • Synapse Differentiation-Inducing Gene Protein 1-Like
  • SYNDIG1L
  • Transmembrane Protein 90A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-30935
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM90A Antibody (NBP2-30935) (0)

There are no publications for TMEM90A Antibody (NBP2-30935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM90A Antibody (NBP2-30935) (0)

There are no reviews for TMEM90A Antibody (NBP2-30935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM90A Antibody (NBP2-30935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM90A Products

Bioinformatics Tool for TMEM90A Antibody (NBP2-30935)

Discover related pathways, diseases and genes to TMEM90A Antibody (NBP2-30935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM90A

There are no specific blogs for TMEM90A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM90A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNDIG1L
Uniprot