TMEM90A Antibody


Immunohistochemistry: TMEM90A Antibody [NBP2-30430] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TMEM90A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRPSCLLGRDKVKE
Specificity of human TMEM90A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM90A Protein (NBP2-30430PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM90A Antibody

  • Caudate- And Putamen-Enriched Sequence
  • Caudate-And Putamen-Enriched Sequence
  • Dispanin Subfamily C Member 1
  • DSPC1
  • Interferon Induced Transmembrane Protein Domain Containing 4
  • Synapse Differentiation Inducing 1-Like
  • Synapse Differentiation-Inducing Gene Protein 1-Like
  • Transmembrane Protein 90A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TMEM90A Antibody (NBP2-30430) (0)

There are no publications for TMEM90A Antibody (NBP2-30430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM90A Antibody (NBP2-30430) (0)

There are no reviews for TMEM90A Antibody (NBP2-30430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM90A Antibody (NBP2-30430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TMEM90A Products

Bioinformatics Tool for TMEM90A Antibody (NBP2-30430)

Discover related pathways, diseases and genes to TMEM90A Antibody (NBP2-30430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM90A

There are no specific blogs for TMEM90A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM90A Antibody and receive a gift card or discount.


Gene Symbol SYNDIG1L