TMEM87A Antibody

Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human cerebral cortex, gastrointestinal, pancreas and prostate using Anti-TMEM87A antibody NBP1-90532 (A) shows similar protein distribution across tissues to independent antibody NBP1-90531 (B).

Western Blot: TMEM87A Antibody [NBP1-90532] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver

Immunocytochemistry/Immunofluorescence: TMEM87A Antibody [NBP1-90532] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human cerebral cortex shows strong cytoplasmic granular positivity in neurons.

Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TMEM87A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGMKMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVTDVALPALLDSDEERMITHFE
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM87A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM87A Protein (NBP1-90532PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM87A Antibody

• DKFZp564G2022
• FLJ11273
• MGC33727
• PSEC0094
• TMEM87A
• transmembrane protein 87A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM87A