![Immunocytochemistry/Immunofluorescence: TMEM87A Antibody [NBP1-90532] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TMEM87A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90532-img0009.jpg "Immunocytochemistry/Immunofluorescence: TMEM87A Antibody [NBP1-90532] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGMKMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVTDVALPALLDSDEERMITHFE |
| Predicted Species | Mouse (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM87A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-90532 | Applications | Species |
|---|---|---|
| Subkhangulova A, Gonzalez-Lozano MA, Groffen AJA et al. Tomosyn affects dense core vesicle composition but not exocytosis in mammalian neurons Elife 2023-09-11 [PMID: 37695731] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
| van Bommel DM, Toonen RF, Verhage M. Mapping localization of 21 endogenous proteins in the Golgi apparatus of rodent neurons Scientific Reports 2023-02-18 [PMID: 36806293] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
| van Bommel DM, Toonen RF, Verhage M Vti1a/b support distinct aspects of TGN and cis-/medial Golgi organization Scientific reports 2022-12-02 [PMID: 36460703] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMEM87A |
![Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human cerebral cortex, gastrointestinal, pancreas and prostate using Anti-TMEM87A antibody NBP1-90532 (A) shows similar protein distribution across tissues to independent antibody NBP1-90531 (B).](http://images.novusbio.com/fullsize/TMEM87A-Antibody-Immunohistochemistry-Paraffin-NBP1-90532-img0018.jpg "Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human cerebral cortex, gastrointestinal, pancreas and prostate using Anti-TMEM87A antibody NBP1-90532 (A) shows similar protein distribution across tissues to independent antibody NBP1-90531 (B).")
![Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/TMEM87A-Antibody-Immunohistochemistry-Paraffin-NBP1-90532-img0017.jpg "Immunohistochemistry-Paraffin: TMEM87A Antibody [NBP1-90532] - Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")