Description | Novus Biologicals Rabbit TMEM87A Antibody - BSA Free (NBP1-90532) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM87A Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGMKMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVTDVALPALLDSDEERMITHFE |
Predicted Species | Mouse (98%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TMEM87A |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-90532 | Applications | Species |
---|---|---|
Subkhangulova A, Gonzalez-Lozano MA, Groffen AJA et al. Tomosyn affects dense core vesicle composition but not exocytosis in mammalian neurons Elife 2023-09-11 [PMID: 37695731] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
van Bommel DM, Toonen RF, Verhage M. Mapping localization of 21 endogenous proteins in the Golgi apparatus of rodent neurons Scientific Reports 2023-02-18 [PMID: 36806293] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
van Bommel DM, Toonen RF, Verhage M Vti1a/b support distinct aspects of TGN and cis-/medial Golgi organization Scientific reports 2022-12-02 [PMID: 36460703] (Immunocytochemistry/ Immunofluorescence, Mouse) | Immunocytochemistry/ Immunofluorescence | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TMEM87A |