TMEM253 Antibody


Immunohistochemistry-Paraffin: TMEM253 Antibody [NBP2-14768] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TMEM253 Antibody [NBP2-14768] - Staining of human small intestine shows strong cytoplasmic positivity in a subset of glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TMEM253 Antibody [NBP2-14768] - Staining in human duodenum and liver tissues using anti-TMEM253 antibody. Corresponding TMEM253 RNA-seq data are presented for more

Product Details

Reactivity HuSpecies Glossary
Applications IHC
Validated by:

Orthogonal Strategies


Order Details

TMEM253 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: LLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQREQTRAALLPP
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM253 Protein (NBP2-14768PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM253 Antibody

  • C14orf176 chromosome 14 open reading frame 176
  • C14orf176
  • C14orf95
  • NCRNA00220


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM253 Antibody (NBP2-14768) (0)

There are no publications for TMEM253 Antibody (NBP2-14768).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM253 Antibody (NBP2-14768) (0)

There are no reviews for TMEM253 Antibody (NBP2-14768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM253 Antibody (NBP2-14768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM253 Antibody and receive a gift card or discount.


Gene Symbol TMEM253