TMEM251 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM251 Antibody [NBP2-14644] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus & cell junctions.
Immunohistochemistry-Paraffin: TMEM251 Antibody [NBP2-14644] - Staining of human kidney shows moderate membranous and cytoplasmic positivity in leukocytes.
Immunohistochemistry-Paraffin: TMEM251 Antibody [NBP2-14644] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in leukocytes.
Immunohistochemistry-Paraffin: TMEM251 Antibody [NBP2-14644] - Staining of human skeletal muscle shows no positivity in myoctes.
Staining of human spleen shows strong membranous and cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM251 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
Predicted Species
Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM251
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM251 Protein (NBP2-14644PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -70C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM251 Antibody

  • C14orf109
  • TMEM251 transmembrane protein 251

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM251 Antibody (NBP2-14644) (0)

There are no publications for TMEM251 Antibody (NBP2-14644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM251 Antibody (NBP2-14644) (0)

There are no reviews for TMEM251 Antibody (NBP2-14644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM251 Antibody (NBP2-14644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM251 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM251