TMEM170A Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM170A Antibody [NBP2-31593] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM170A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM170A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM170A Protein (NBP2-31593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM170A Antibody

  • FLJ37611
  • TMEM170
  • transmembrane protein 170
  • transmembrane protein 170A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM170A Antibody (NBP2-31593) (0)

There are no publications for TMEM170A Antibody (NBP2-31593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM170A Antibody (NBP2-31593) (0)

There are no reviews for TMEM170A Antibody (NBP2-31593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM170A Antibody (NBP2-31593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM170A Products

Bioinformatics Tool for TMEM170A Antibody (NBP2-31593)

Discover related pathways, diseases and genes to TMEM170A Antibody (NBP2-31593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM170A

There are no specific blogs for TMEM170A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM170A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM170A
Uniprot