TMEM169 Antibody


Immunohistochemistry-Paraffin: TMEM169 Antibody [NBP2-49642] - Staining of human lateral ventricle shows moderate positivity in glial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TMEM169 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RYVTLTGTITRGKKKGQMVDIHVTLTEKELQELTKPKESSRETTPEGRMACQMGADR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM169 Recombinant Protein Antigen (NBP2-49642PEP)

Reactivity Notes

Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM169 Antibody

  • DKFZp781L2456
  • FLJ34263
  • transmembrane protein 169


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM169 Antibody (NBP2-49642) (0)

There are no publications for TMEM169 Antibody (NBP2-49642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM169 Antibody (NBP2-49642) (0)

There are no reviews for TMEM169 Antibody (NBP2-49642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM169 Antibody (NBP2-49642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM169 Products

Bioinformatics Tool for TMEM169 Antibody (NBP2-49642)

Discover related pathways, diseases and genes to TMEM169 Antibody (NBP2-49642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM169

There are no specific blogs for TMEM169, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM169 Antibody and receive a gift card or discount.


Gene Symbol TMEM169