| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TMEM165 Antibody - BSA Free (NBP1-90651) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM165 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM165 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-90651 | Applications | Species |
|---|---|---|
| Foulquier F, Amyere M, Jaeken J et al. TMEM165 Deficiency Causes a Congenital Disorder of Glycosylation. Am J Hum Genet 2012-07-13 [PMID: 22683087] | ||
| Venkat S. Sorting of Oligomerized Proteins: Implications in Toxin Trafficking and Quality Control. Thesis. 2017-09-09 (ICC/IF, Human) | ICC/IF | Human |
| Venkat S, Linstedt AD Manganese-induced trafficking and turnover of GPP130 is mediated by sortilin Mol Biol Cell. 2017-09-14 [PMID: 28768823] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TMEM165 Antibody (NBP1-90651)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMEM165 |