TMEM165 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM165 Antibody [NBP1-90651] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human colon shows strong granular cytoplasmic positivity with additional membranous staining in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM165 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM165
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM165 Protein (NBP1-90651PEP)
Publications
Read Publications using
NBP1-90651 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22683087)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM165 Antibody

  • transmembrane protein 165

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM165 Antibody (NBP1-90651)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-90651 Applications Species
Foulquier F, Amyere M, Jaeken J et al. TMEM165 Deficiency Causes a Congenital Disorder of Glycosylation. Am J Hum Genet 2012 Jul 13 [PMID: 22683087]
Venkat S. Sorting of Oligomerized Proteins: Implications in Toxin Trafficking and Quality Control. Thesis. 2017 Sep 09 (ICC/IF, Human) ICC/IF Human

Reviews for TMEM165 Antibody (NBP1-90651) (0)

There are no reviews for TMEM165 Antibody (NBP1-90651). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM165 Antibody (NBP1-90651) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM165 Products

TMEM165 NBP1-90651

Bioinformatics Tool for TMEM165 Antibody (NBP1-90651)

Discover related pathways, diseases and genes to TMEM165 Antibody (NBP1-90651). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM165 Antibody (NBP1-90651)

Discover more about diseases related to TMEM165 Antibody (NBP1-90651).
 

Pathways for TMEM165 Antibody (NBP1-90651)

View related products by pathway.

PTMs for TMEM165 Antibody (NBP1-90651)

Learn more about PTMs related to TMEM165 Antibody (NBP1-90651).

Blogs on TMEM165

There are no specific blogs for TMEM165, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM165 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM165