TMEM165 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TMEM165 Antibody [NBP1-90651] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human Urinary bladder shows strong granular cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human colon shows strong granular cytoplasmic positivity with additional membranous staining in glandular cells.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Analysis in human placenta and skeletal muscle tissues using NBP1-90651 antibody. Corresponding TMEM165 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human Endometrium shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human Placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TMEM165 Antibody [NBP1-90651] - Staining of human Skeletal muscle shows very weak granular cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM165 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM165 Antibody - BSA Free (NBP1-90651) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM165 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM165
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM165 Protein (NBP1-90651PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22683087)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM165 Antibody - BSA Free

• transmembrane protein 165

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM165 Antibody (NBP1-90651)(3)

Publications using NBP1-90651

• Foulquier F, Amyere M, Jaeken J et al. TMEM165 Deficiency Causes a Congenital Disorder of Glycosylation. Am J Hum Genet 2012-07-13 [PMID: 22683087]
• Venkat S. Sorting of Oligomerized Proteins: Implications in Toxin Trafficking and Quality Control. Thesis. 2017-09-09 (ICC/IF, Human)
• Venkat S, Linstedt AD Manganese-induced trafficking and turnover of GPP130 is mediated by sortilin Mol Biol Cell. 2017-09-14 [PMID: 28768823] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: TMEM165