TMEM155 Antibody


Immunohistochemistry-Paraffin: TMEM155 Antibody [NBP2-69046] - Staining of human cerebral cortex shows strong positivity in neuropil.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TMEM155 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTR
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
TMEM155 Recombinant Protein Antigen (NBP2-69046PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for TMEM155 Antibody

  • Transmembrane Protein 155


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM155 Antibody (NBP2-69046) (0)

There are no publications for TMEM155 Antibody (NBP2-69046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM155 Antibody (NBP2-69046) (0)

There are no reviews for TMEM155 Antibody (NBP2-69046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM155 Antibody (NBP2-69046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TMEM155 Products

Bioinformatics Tool for TMEM155 Antibody (NBP2-69046)

Discover related pathways, diseases and genes to TMEM155 Antibody (NBP2-69046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM155

There are no specific blogs for TMEM155, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM155 Antibody and receive a gift card or discount.


Gene Symbol TMEM155