TMEM108 Antibody

Western Blot: TMEM108 Antibody [NBP1-57849] - WB Suggested Anti-TMEM108 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TMEM108 Antibody Summary

• Immunogen: Synthetic peptides corresponding to TMEM108 (transmembrane protein 108) The peptide sequence was selected from the middle region of TMEM108. Peptide sequence NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM108
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against TMEM108 and was validated on Western blot.
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM108 Antibody

• cancer/testis antigen 124
• CT124
• KIAA1690
• MGC3040
• transmembrane protein 108

Background

TMEM108's function has not been determined yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM108
• Uniprot:
  • Q6UXF1-2(Human)