TMEM108 Antibody

Images

 
There are currently no images for TMEM108 Antibody (NBP1-57849).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

TMEM108 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM108 (transmembrane protein 108) The peptide sequence was selected from the middle region of TMEM108. Peptide sequence NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI.
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM108
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM108 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-57849 in the following applications:

  • WB
    1 publication

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM108 Antibody

  • cancer/testis antigen 124
  • CT124
  • KIAA1690
  • MGC3040
  • transmembrane protein 108

Background

TMEM108's function has not been determined yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89077
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3429
Species: Hu
Applications: WB
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-57849
Species: Hu
Applications: WB

Publications for TMEM108 Antibody (NBP1-57849)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM108 Antibody (NBP1-57849) (0)

There are no reviews for TMEM108 Antibody (NBP1-57849). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM108 Antibody (NBP1-57849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM108 Antibody Products

TMEM108 NBP1-57849

Related Products by Gene

Bioinformatics Tool for TMEM108 Antibody (NBP1-57849)

Discover related pathways, diseases and genes to TMEM108 Antibody (NBP1-57849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMEM108 Antibody (NBP1-57849)

View related products by pathway.

Blogs on TMEM108

There are no specific blogs for TMEM108, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TMEM108
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-57849 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought