TMCO3 Antibody

Images

 
Western Blot: TMCO3 Antibody [NBP2-48709] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry: TMCO3 Antibody [NBP2-48709] - Staining of human breast shows strong positivity in a subset of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMCO3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SVFQAVYGLQRALQGDYKDVVNMKESSRQRLEALREAAIKEETEYMELLAAEKHQVEALKNMQHQNQSLSMLDE
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMCO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMCO3 Recombinant Protein Antigen (NBP2-48709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMCO3 Antibody

  • B230339H12Rik
  • C13orf11
  • chromosome 13 open reading frame 11
  • FLJ20623
  • Putative LAG1-interacting protein
  • transmembrane and coiled-coil domain-containing protein 3
  • transmembrane and coiled-coil domains 3

Background

TMCO3, also known as Transmembrane And Coiled-Coil Domains 3, has a 677 amino acid long isoform that is approximately 76kDa, and two shorter isoforms that are 545 and 414 amino acids in length, respectively. TMCO3 is a membrane protein and may act as a sodium-hydrogen antiporter. Current research on TMCO3 has been conducted in relation to several diseases and disorders including dystonia and tuberculosis. TMCO3 has also been shown to have interactions with EGFR, ELAVL1 and Ubiquitin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMCO3 Antibody (NBP2-48709) (0)

There are no publications for TMCO3 Antibody (NBP2-48709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMCO3 Antibody (NBP2-48709) (0)

There are no reviews for TMCO3 Antibody (NBP2-48709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMCO3 Antibody (NBP2-48709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMCO3 Products

Array NBP2-48709

Bioinformatics Tool for TMCO3 Antibody (NBP2-48709)

Discover related pathways, diseases and genes to TMCO3 Antibody (NBP2-48709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMCO3

There are no specific blogs for TMCO3, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMCO3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMCO3