THEM5 Antibody

Images

 
Western Blot: THEM5 Antibody [H00284486-B01P] - Analysis of THEM5 expression in transfected 293T cell line by THEM5 polyclonal antibody. Lane1:THEM5 transfected lysate(27.17 KDa). Lane2:Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

THEM5 Antibody Summary

Immunogen
THEM5 (NP_872384.1, 1 a.a. - 247 a.a.) full-length human protein. MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLYQEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVEVDKIEDQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ
Specificity
Reacts with thioesterase superfamily member 5.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
THEM5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for THEM5 Antibody

  • FLJ37964
  • MGC126659
  • MGC138444
  • thioesterase superfamily member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77360
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00023597-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
H00284486-B01P
Species: Hu
Applications: WB

Publications for THEM5 Antibody (H00284486-B01P) (0)

There are no publications for THEM5 Antibody (H00284486-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THEM5 Antibody (H00284486-B01P) (0)

There are no reviews for THEM5 Antibody (H00284486-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THEM5 Antibody (H00284486-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional THEM5 Products

Bioinformatics Tool for THEM5 Antibody (H00284486-B01P)

Discover related pathways, diseases and genes to THEM5 Antibody (H00284486-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THEM5 Antibody (H00284486-B01P)

Discover more about diseases related to THEM5 Antibody (H00284486-B01P).
 

Pathways for THEM5 Antibody (H00284486-B01P)

View related products by pathway.

Blogs on THEM5

There are no specific blogs for THEM5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THEM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THEM5
Entrez
Uniprot