TCEAL5 Antibody

Images

 
Immunohistochemistry-Paraffin: TCEAL3 Antibody [NBP2-54723] - Staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCEAL5 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK
Specificity
Specificity of human TCEAL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEAL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TCEAL5 Recombinant Protein Antigen (NBP2-54723PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%),

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCEAL5 Antibody

  • TCEA-like protein 5
  • transcription elongation factor A (SII)-like 5
  • transcription elongation factor A protein-like 5
  • Transcription elongation factor S-II protein-like 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCEAL5 Antibody (NBP2-54723) (0)

There are no publications for TCEAL5 Antibody (NBP2-54723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEAL5 Antibody (NBP2-54723) (0)

There are no reviews for TCEAL5 Antibody (NBP2-54723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TCEAL5 Antibody (NBP2-54723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TCEAL5 Products

Bioinformatics Tool for TCEAL5 Antibody (NBP2-54723)

Discover related pathways, diseases and genes to TCEAL5 Antibody (NBP2-54723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TCEAL5

There are no specific blogs for TCEAL5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEAL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEAL5